thedailydesmadre.wordpress.com
🖥 Status: up
🕒 Response Time: 0.018 sec
⬅️ Response Code: 200
Starting on January 7, 2025, and lasting for 584 days, 10 times, thedailydesmadre.wordpress.com was inspected for availability. With the last operable on June 19, 2026, returning a 200 status code, thedailydesmadre.wordpress.com was up 10 times out of every check performed. Based on checks made as of August 14, 2026, thedailydesmadre.wordpress.com did not experience any unavailability incidents. As of August 14, 2026, no error responses had been noted in the replies that were received. The data from June 19, 2026, reveals that thedailydesmadre.wordpress.com responded in 0.018 seconds, in contrast to the 0.390 seconds average response time.
10
Last Updated: June 19, 2026
Thedailydesmadre.wordpress overview
- Domain
- thedailydesmadre.wordpress.com
- Registered domain
- wordpress.com
- Title
- The Daily Desmadre | Narratives, Realities, Truth
- Description
- Our world is a place of increasingly polarized and fragmented realities. Many react out of desperation, citing bases for action grounded solely in the immediacy of personal experience and not in the historical or in fact.
- Main Topic
- The Daily Desmadre
Narratives, Realities, Truth
Follow Blog via Email
Archives
Recent Posts
Site Categories
Washington Post
The Hill
The Guardian
US News & World Report
Reuters
Wall Street Journal
New York Times
BBC World News
Politico
Mother Jones
Daily Mail
Rolling Stone - P Site Status Rank
- 287 781
- Search Wikipedia
- thedailydesmadre.wordpress.com
- Alternatives
- alternatives to thedailydesmadre.wordpress.com
- Recently checked
- mp3-xtreme.com
estadosecapitaisdobrasil.com
Last Updated: April 23, 2026
Status: up
Response Time: 0.727 sec
Response Code: 200
paradigmlife.net
Last Updated: May 30, 2026
Status: error
Response Time: 0.015 sec
Response Code: 403
actividadesdeinfantilyprimaria.com
Last Updated: May 10, 2026
Status: up
Response Time: 0.198 sec
Response Code: 200
Thedailydesmadre.wordpress.com
status check request map as of August 14, 2026
Country report for thedailydesmadre.wordpress.com as of August 14, 2026
| United States | 100.00% | ||||||||
| 22:32 | |||||||||
| Site | Total Checks | Last Modified |
|---|---|---|
| 5 | February 22, 2019 | |
| 5 | October 23, 2025 | |
 thedailydesmadre.wordpress.com | 10 | January 7, 2025 |
| 5 | January 4, 2025 | |
| 14 | May 12, 2024 |
Parkablogs.com | Thedailydesmadre.wordpress.com | ||||
|---|---|---|---|---|---|
General SEO Report
| Page Title | Page Title tips for thedailydesmadre.wordpress.com: When crafting the website's 'Title', keyword research is your prime directive; discover long-tail opportunities semantic variations effective optimizations that precisely target user journey stage ideal matching intent perfectly. |
|---|---|
| The Daily Desmadre | Narratives, Realities, Truth Length: 49 characters | |
| Meta Description | Meta Description tips for thedailydesmadre.wordpress.com: Enhancing user experience through compelling meta descriptions encourages click-through and improves bannering rates; focus on clear language, a benefit-oriented approach, and a natural flow within the 160-character limit to accurately represent the page and meet search intent effectively. |
| Our world is a place of increasingly polarized and fragmented realities. Many react out of desperation, citing bases for action grounded solely in the immediacy of personal experience and not in the historical or in fact. Length: 221 characters | |
| Meta Keywords | Meta Keywords tips for thedailydesmadre.wordpress.com: Keyword research should guide your content creation strategy; ensure your chosen keywords are naturally woven into titles, headers, and the main content body. |
| no meta keywords data for thedailydesmadre.wordpress.com 2026-08-14T09:01:18+00:00 | |
| Page Content | Page Content tips for thedailydesmadre.wordpress.com: Maintain a logical flow and clear progression in your page content, starting with an introduction that outlines the topic, developing key points sequentially, and concluding with a summary or relevant call-to-action for the user. |
| Web Page Content Length: 71970 characters | |
| H1 Heading | H1 Heading tips for thedailydesmadre.wordpress.com: For best practices, choose one clear, concise, and compelling h1 header per page that accurately reflects the page's content, avoiding duplication or multiple conflicting headlines that confuse users and search engines. |
| The Daily Desmadre Narratives, Realities, Truth Follow Blog via Email Archives Recent Posts Site Categories Washington Post The Hill The Guardian US News & World Report Reuters Wall Street Journal New York Times BBC World News Politico Mother Jones Daily Mail Rolling Stone Count: 18 heading tag | |
| H2 Headings | H2 Headings tips for thedailydesmadre.wordpress.com: H2 headings not only improve user experience by organizing content but also help establish topical authority, signaling to search engines the page's main themes. |
| ~ Narratives, Realities, Truth Count: 1 heading tag | |
| H3 Headings | H3 Headings tips for thedailydesmadre.wordpress.com: H3 headings play a vital role in content schema markup by helping search engines understand the topical relationships and structure of your information; well-structured H3s improve the potential for rich results and structured data. |
| Share this: Leave a comment Cancel reply Count: 2 heading tag | |
| H4 Headings | H4 Headings tips for thedailydesmadre.wordpress.com: H4 headings are particularly useful for structuring recurring elements on webpages like sidebar widgets, pull quotes, or distinct feature lists, maintaining a clear visual and semantic hierarchy throughout the entire page layout. |
| no h4 headings data for thedailydesmadre.wordpress.com 2026-08-14T09:01:18+00:00 | |
| H5-H6 Headings | H5-H6 Headings tips for thedailydesmadre.wordpress.com: For improved website navigation, use H5 and H6 tags to logically categorize content within a chapter or section on a topic page, facilitating smoother user interaction. |
| no h5-h6 headings data for thedailydesmadre.wordpress.com 2026-08-14T09:01:19+00:00 | |
| Image ALT Attributes | Image ALT Attributes tips for thedailydesmadre.wordpress.com: Provide concise yet highly descriptive alternative text for images, focusing on conveying the main subject and function to users employing screen readers for accessibility. |
| https://thedailydesmadre.wordpress.com/wp-content/uploads/2017/10/th-37.jpg?w=960&h=260&crop=1 https://s.wordpress.com/wp-includes/images/rss.png?m=1354137473i Count: 2 images with ALT attributes | |
| Robots.txt | Robots.txt tips for thedailydesmadre.wordpress.com: Never use the robots.txt file as a means to password-protect sensitive content or hide information from users; consider alternative security measures instead. |
| file robots.txt was found on the website | |
| XML Sitemap | XML Sitemap tips for thedailydesmadre.wordpress.com: Regularly update your XML sitemap whenever you add new content or make significant structural changes to your website, and submit changes via Search Console to ensure search engines have access to the most current inventory of your pages for optimal indexing performance. |
| no xml sitemap data for thedailydesmadre.wordpress.com 2026-08-14T09:01:19+00:00 | |
| Page Size | Page Size tips for thedailydesmadre.wordpress.com: Slow-loading pages, characterized by large file sizes, can directly harm your SEO performance by resulting in lower rankings in search results and driving away potential customers or readers who lose interest before content is displayed. |
| page size: 70 kb | |
| Response Time | Response Time tips for thedailydesmadre.wordpress.com: Regularly profiling your website's backend code to identify slow functions or inefficient database queries is essential for reducing overall response time and improving site performance, which search engines heavily favour |
| response time: 0.390 sec | |
| Minify CSS | Minify CSS tips for thedailydesmadre.wordpress.com: Consider minifying CSS as part of a proactive SEO strategy focused on performance, as smaller, optimized files directly impact page loading speed, which search engines increasingly rank favorably, leading to better discoverability and higher click-through rates. |
| Minified: /wp-content/plugins/gutenberg-core/v21.1.0/build/block-library/style.css?m=1762168648i&cssminify=yes /_static/??-eJzTLy/QzcxLzilNSS3WzyrWz01NyUxMzUnNTc0rQeEU5CRWphbp5qSmJyZX6uVm5uklFxfr6OPTDpRD5sM02efaGpoZmFkYGRuZGmQBAHPvL0Y=&cssminify=yes /wp-content/mu-plugins/jetpack-mu-wpcom-plugin/sun/jetpack_vendor/automattic/jetpack-mu-wpcom/src/build/verbum-comments/verbum-comments.css?m=1760015937i&cssminify=yes https://widgets.wp.com/verbum-block-editor/block-editor.css?ver=1738686361 /wp-content/mu-plugins/jetpack-plugin/sun/_inc/build/subscriptions/subscriptions.min.css?m=1753981412i&cssminify=yes Unminified: /_static/??/wp-content/mu-plugins/likes/jetpack-likes.css,/wp-content/blog-plugins/marketing-bar/css/marketing-bar.css?m=1761640963j&cssminify=yes /_static/??-eJyVzDEOgCAMQNELiQU1Jg7Gs2AlDYpAaInx9ro5O/7hfbiywhTFRYEcKvnIQPXN1RVSa0h4MOxOssVDBXunKoqK34DlDq5F5gb+LIoVH4k/vpyzGYe+03oyw/4AcmU1KQ==&cssminify=yes /_static/??/wp-content/mu-plugins/core-compat/wp-mediaelement.css,/wp-content/mu-plugins/wpcom-bbpress-premium-themes.css?m=1432920480j&cssminify=yes /_static/??-eJyNTtEKwjAM/CFrmJOJD+K3dCV20bYpa8rw740OdCqIb3eXu8vBlI3jJJgEYjU5VE+pgOMYVTKBLqisfChrVVZAkFhI0+UJ5sOiUwaM2pBrD26wgrZCkWvAf4yU3Gw2U9b3X5HF3hH7wF6hf4x90V8hj2wCOyvE6Y2YU7A03qPHeGh226bbt+2mO98AMntwJw==&cssminify=yes /wp-content/mu-plugins/global-print/global-print.css?m=1465851035i&cssminify=yes /_static/??-eJyNjcsKAjEMRX/IGtQZBxfip0hMS9sxTYppGfx7H7gRN+7ugcs5sFRHKi1Ig9Jd5R6zGMyhVaTrh8G6QFHfORhYwlvw6P39PbPENZmt4G/ROQuBKWVkxxrVvuBH1lIoz2waILJekF+HUzlupnG3nQ77YZwfuRJIaQ==&cssminify=yes included in the page | |
| Minify JavaScript | Minify JavaScript tips for thedailydesmadre.wordpress.com: JavaScript minification is a fundamental frontend optimization technique that, alongside image compression and caching, forms the backbone of a high-performance website favored by search engines. |
| Minified: /wp-content/js/rlt-proxy.js?m=1720530689i /wp-content/plugins/gutenberg-core/v21.1.0/build/hooks/index.min.js?m=1762168648i&ver=84e753e2b66eb7028d38 /wp-content/plugins/gutenberg-core/v21.1.0/build/i18n/index.min.js?m=1762168648i&ver=bd5a2533e717a1043151 /wp-content/blog-plugins/wordads-classes/js/cmp/v2/cmp-stub.js?m=1707933448i //0.gravatar.com/js/hovercards/hovercards.min.js?ver=202546924dcd77a86c6f1d3698ec27fc5da92b28585ddad3ee636c0397cf312193b2a1 /wp-content/mu-plugins/gravatar-hovercards/wpgroho.js?m=1610363240i https://assets.tumblr.com/share-button.js /_static/??/wp-content/blog-plugins/wordads-classes/js/watl-v2.js,/wp-content/mu-plugins/likes/queuehandler.js?m=1760446017j /wp-content/mu-plugins/jetpack-mu-wpcom-plugin/sun/jetpack_vendor/automattic/jetpack-mu-wpcom/src/build/verbum-comments/assets/dynamic-loader.js?m=1755011788i&minify=false&ver=adc3e7b923a66edb437b /wp-content/mu-plugins/jetpack-plugin/sun/_inc/build/sharedaddy/sharing.min.js?m=1755011788i //stats.wp.com/w.js?68 /wp-content/js/bilmur.min.js?i=17&m=202546 Unminified: //translate.google.com/translate_a/element.js?cb=googleTranslateElementInit&ver=15.3-a.0 detected during site scan | |
| Structured Data | Structured Data tips for thedailydesmadre.wordpress.com: Integrating comprehensive Schema markup directly into your HTML, beyond just basic page information, empowers search engines with precise data context, significantly increasing the likelihood of rich snippets appearing and attracting more qualified traffic to your website. |
| no structured data data for thedailydesmadre.wordpress.com 2026-08-14T09:01:19+00:00 | |
| CDN Usage | CDN Usage tips for thedailydesmadre.wordpress.com: Integrate fonts and font subsets used on your website with your CDN to accelerate typography rendering and improve overall page speed scores, a key component in modern, fast-loading web experiences and SEO best practices. |
| no cdn usage data for thedailydesmadre.wordpress.com 2026-08-14T09:01:19+00:00 | |
| SSL certificates | SSL certificates tips for thedailydesmadre.wordpress.com: Proper SSL implementation ensures all forms and logins on your site use encrypted connections, which search engines value for user security, directly contributing to improved search rankings and site authority signals. |
| SSL is enabled on the website |
Estimated Traffic
| Minimum Daily Unique Visitors: | 1 872 |
| Minimum Daily Visits: | 2 188 |
| Minimum Daily Page Views: | 3 768 |
| Minimum Monthly Unique Visitors: | 56 160 |
| Minimum Monthly Visits: | 65 640 |
| Minimum Monthly Page Views: | 113 040 |
| Minimum Yearly Unique Visitors: | 673 920 |
| Minimum Yearly Visits: | 787 680 |
| Minimum Yearly Page Views: | 1 356 480 |
| Maximum Daily Unique Visitors: | 2 369 |
| Maximum Daily Visits: | 2 527 |
| Maximum Daily Page Views: | 4 264 |
| Maximum Monthly Unique Visitors: | 71 070 |
| Maximum Monthly Visits: | 75 810 |
| Maximum Monthly Page Views: | 127 920 |
| Maximum Yearly Unique Visitors: | 852 840 |
| Maximum Yearly Visits: | 909 720 |
| Maximum Yearly Page Views: | 1 535 040 |
Estimated Valuation
| Daily Revenue: | US$ 3 - 6 |
| Monthly Revenue: | US$ 90 - 180 |
| Yearly Revenue: | US$ 1 080 - 2 160 |
Estimated Worth
| Minimum: | US$ 1 620 |
| Maximum: | US$ 6 480 |
Similarly Ranked Sites
| Rank | Points | |
|---|---|---|
| 611 892 | 6 309 354 | |
| 611 893 | 6 309 354 | |
| 611 894 | 6 309 353 | |
| 611 895 | 6 309 353 | |
| 611 896 | 6 309 352 | |
| thedailydesmadre.wordpress.com | 611 897 | 6 309 352 |
| 611 898 | 6 309 351 | |
| 611 899 | 6 309 351 | |
| 611 900 | 6 309 350 | |
| 611 901 | 6 309 350 | |
| 611 902 | 6 309 349 |